Bacterial taxon 208964
Protein WP_003083913.1
DUF1987 domain-containing protein
Pseudomona aeruginosa PA01
Gene n/a, UniProt Q9I6W2
>WP_003083913.1|Pseudomona aeruginosa PA01|DUF1987 domain-containing protein
MSDLHIPGTQSTPAIQGDWQAGRLSMQGDSYPENSYELFGQVIDWVERFLADGQRPLELDLRLLYLNTSSIKAMMDILDLLEEAHQGGRPVSLRWHYDRRNERVAELAEEFREDCSFPFAIQAHDE
Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | pathogen | Lung tissue | 16 h | ●●●●● 4.07 | 4.07176929002419 | 1.4e-29 | 32071273 | Bacterial control measured at 37ºC |
Retrieved 1 of 1 entries in 32.9 ms
(Link to these results)