Bacterial taxon 208964
Protein WP_003094862.1
DUF3015 domain-containing protein
Pseudomona aeruginosa PA01
Gene n/a, UniProt Q9HVI2
>WP_003094862.1|Pseudomona aeruginosa PA01|DUF3015 domain-containing protein
MDKRLLSKGLVLGLLSLGSMTAHADAAGGNGCGWGNMVFEGQRGLFPHLLATTTNGTSGNATFGMTSGTNGCNTNARLGYGGRSIFAMNGMLDNIAEDMAKGQGEALDAYAVLLGVEAKDRAHFAQVTQQHFGEIFASKDATGEQVLSNTLAVMSRDGTLARYAKQPA
Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | pathogen | Lung tissue | 16 h | ●●●●○ -3.56 | -3.5601066264018 | 1.1e-169 | 32071273 | Bacterial control measured at 37ºC |
Retrieved 1 of 1 entries in 25.1 ms
(Link to these results)