Bacterial taxon 208964
Protein WP_003122604.1
DUF4442 domain-containing protein
Pseudomona aeruginosa PA01
Gene n/a, UniProt Q9I0K2
>WP_003122604.1|Pseudomona aeruginosa PA01|DUF4442 domain-containing protein
MECRLPSLWKDASMPKRNRLSRAVGAINLLPRRLRSRSLTLLLGSQVRFAGTARVRIHELGQERAILSLKNRRPVQNHIKGIHAAAMALLAESASGFLVGMNVPDDKLPLIKTMKIDYLKRAQGNLTAIATLEAGQIEQIRQQDKGEVRVAVLVSDENGNQPIACEMVWAWVGKKPRVATAAPR
Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | pathogen | Lung tissue | 16 h | ●●●●● -4.49 | -4.49135570673072 | 1.6e-16 | 32071273 | Bacterial control measured at 37ºC |
Retrieved 1 of 1 entries in 53.9 ms
(Link to these results)