Host taxon 10090
Protein NP_705724.1
E3 ubiquitin-protein ligase RNF183
Mus musculus
Gene Rnf183, UniProt Q8QZS5
>NP_705724.1|Pseudomona aeruginosa PA01|E3 ubiquitin-protein ligase RNF183
MSEPQGQELRAECPVCWNPFNNTFHTPKVLDCCHSFCVECLAHLSLVTPARRRLLCPLCRQPTVLASGQPVTDLPTDTAMLTLLRLEPHHVILEGHQLCLKDQPKSRYFLRQPRVYTLDLGAEPGSQTGLPQDTAPDTRPVPIPSHYSLRECVRNPHFRIFAYLMAVILSVTLLLIFSIFWTKQFFWGMG
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●●●○ 3.67 | 3.67218444160579 | 0.0098 | 32071273 | |
Retrieved 1 of 1 entries in 42.1 ms
(Link to these results)