Host taxon 10090
Protein NP_766138.3
endoribonuclease YbeY
Mus musculus
Gene Ybey, UniProt Q8CAV0
>NP_766138.3|Pseudomona aeruginosa PA01|endoribonuclease YbeY
MSLVIKNLQRVVPIRRVPLRRKMDLVRSILGVKKFDLGIICVDNKTIQNINRIYRNKNVPTDVLSFSFHENLKAGEFPQPHSPDDYNLGDIFLGVEYILQHCRESEDYCDVLTVTATHGLCHLLGFTHSSKAEWQKMYNQEKLVLEELSRYTGARLQPLSRGLY
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●●●○ -3.51 | -3.50751124271501 | 5.5e-6 | 32071273 | |
Retrieved 1 of 1 entries in 2.7 ms
(Link to these results)