Bacterial taxon 208964
Protein WP_003097128.1
F0F1 ATP synthase subunit epsilon
Pseudomona aeruginosa PA01
Gene atpC, UniProt Q9HT21
>WP_003097128.1|Pseudomona aeruginosa PA01|F0F1 ATP synthase subunit epsilon
MAITVHCDIVSAEAEIFSGLVEMVIAHGALGDLGIAPGHAPLITDLKPGPIRLVKQGGEQEVYYISGGFLEVQPNMVKVLADTVVRAGDLDEAAAQEALKAAEKALQGKGAEFDYSAAAARLAEAAAQLRTVQQLRKKFGG
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | pathogen | Lung tissue | 16 h | ●●●○○ 3 | 2.99995007068364 | 4.9e-243 | 32071273 | Bacterial control measured at 37ºC |
Retrieved 1 of 1 entries in 3.7 ms
(Link to these results)