Host taxon 10090
Protein NP_059095.1
fatty acid-binding protein, liver
Mus musculus
Gene Fabp1, UniProt P12710
>NP_059095.1|Pseudomona aeruginosa PA01|fatty acid-binding protein, liver
MNFSGKYQLQSQENFEPFMKAIGLPEDLIQKGKDIKGVSEIVHEGKKIKLTITYGPKVVRNEFTLGEECELETMTGEKVKAVVKLEGDNKMVTTFKGIKSVTELNGDTITNTMTLGDIVYKRVSKRI
Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●●●○ -3.43 | -3.43105474927097 | 0.0045 | 32071273 | |
Retrieved 1 of 2 entries in 40.6 ms
(Link to these results)