Host taxon 10090
Protein NP_001278033.1
fibroblast growth factor 11 isoform 2
Mus musculus
Gene Fgf11, UniProt P70378
>NP_001278033.1|Pseudomona aeruginosa PA01|fibroblast growth factor 11 isoform 2
MAALASSLIRQKREVREPGGSRPVSAQRRVCPRGTKSLCQKQLLILLSKVRLCGGRPTRQDRGPEPQLKGIVTKLFCRQGFYLQANPDGSIQGTPEDTSSFTHFNLIPVGLRVVTIQSAKLGHYMAMNAEGLLYSSRRSGRAWYLGLDKEGRVMKGNRVKKTKAAAHFVPKLLEVAMYREPSLHSVPETSPSSPPAH
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●●●○ -3.23 | -3.23111470460075 | 1.6e-6 | 32071273 | |
Retrieved 1 of 2 entries in 3.4 ms
(Link to these results)