Bacterial taxon 208964
Protein WP_003098728.1
fucose-binding lectin PA-IIL
Pseudomona aeruginosa PA01
Gene lecB, UniProt Q9HYN5
>WP_003098728.1|Pseudomona aeruginosa PA01|fucose-binding lectin PA-IIL
MATQGVFTLPANTRFGVTAFANSSGTQTVNVLVNNETAATFSGQSTNNAVIGTQVLNSGSSGKVQVQVSVNGRPSDLVSAQVILTNELNFALVGSEDGTDNDYNDAVVVINWPLG
Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | pathogen | Lung tissue | 16 h | ●●●●● -7.11 | -7.11027378746414 | 4.9e-108 | 32071273 | Bacterial control measured at 37ºC |
Retrieved 1 of 1 entries in 71.3 ms
(Link to these results)