Host taxon 10090
Protein NP_034383.1
galanin peptides isoform 1 preproprotein
Mus musculus
Gene Gal, UniProt P47212
>NP_034383.1|Pseudomona aeruginosa PA01|galanin peptides isoform 1 preproprotein
MARGSVILLGWLLLVVTLSATLGLGMPAKEKRGWTLNSAGYLLGPHAIDNHRSFSDKHGLTGKRELQLEVEERRPGSVDVPLPESNIVRTIMEFLSFLHLKEAGALDSLPGIPLATSSEDLEKS
Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●●●○ 3.07 | 3.06751245942735 | 0.008 | 32071273 | |
Retrieved 1 of 2 entries in 19.7 ms
(Link to these results)