Host taxon 10090
Protein NP_080329.1
gem-associated protein 6
Mus musculus
Gene Gemin6, UniProt Q9CX53
>NP_080329.1|Pseudomona aeruginosa PA01|gem-associated protein 6
MSEWMKKSPLEWEDYVYKEVRVIACEKEYKGWLLTTDPVSANIVLVNFLEDGRLSVTGIMGHSVQTVETISEGDHRVREKLMHVFASGDCKGYSPEDLEEKRTSLKKWLEKNHIPVTEQGDAQRTLCVAGVLTIDPPYAPENCSSSNEIILSRIQDLIQGHLSASQ
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●●●○ -3.85 | -3.8542925380945 | 0.0053 | 32071273 | |
Retrieved 1 of 1 entries in 42.5 ms
(Link to these results)