Bacterial taxon 208964
Protein WP_003119370.1
GlpM family protein
Pseudomona aeruginosa PA01
Gene glpM, UniProt P52112
>WP_003119370.1|Pseudomona aeruginosa PA01|GlpM family protein
MFKALIGAAVVVLLAVLSKTRNYYIAGLVPLFPTFALIAHYIVGKGRSLDDLKTTIVFGMWSIIPYFVYLAALYLLVERFRLETSLALAALAWLVAASVLVGLWVRLHA
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | pathogen | Lung tissue | 16 h | ●●●●○ -3.8 | -3.80354659190624 | 2.6e-36 | 32071273 | Bacterial control measured at 37ºC |
Retrieved 1 of 1 entries in 33.3 ms
(Link to these results)