Host taxon 10090
Protein NP_444338.2
glutaredoxin-1
Mus musculus
Gene Glrx, UniProt Q9QUH0
>NP_444338.2|Pseudomona aeruginosa PA01|glutaredoxin-1
MAQEFVNCKIQSGKVVVFIKPTCPYCRKTQEILSQLPFKQGLLEFVDITATNNTSAIQDYLQQLTGARTVPRVFIGKDCIGGCSDLISMQQTGELMTRLKQIGALQL
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●●●○ 3.21 | 3.2077040482326 | 1.2e-110 | 32071273 | |
Retrieved 1 of 2 entries in 43.1 ms
(Link to these results)