Bacterial taxon 208964
Protein WP_003105215.1
GNAT family N-acetyltransferase
Pseudomona aeruginosa PA01
Gene n/a, UniProt Q9I635
>WP_003105215.1|Pseudomona aeruginosa PA01|GNAT family N-acetyltransferase
MPVHAASLADLADLVPLFSAYLDFYEVPAPEEQVRAFLAERLRQGDSTLFLARDAEARALGFVQLYPLFASLALRPSWLLSDLYVRPEARRRGVGEALMNQARGFAESMGACGLQLETAKTNHAGQSLYERLGYVRDEQFYTYWLQL
Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | pathogen | Lung tissue | 16 h | ●●●●○ -3.57 | -3.5706298478613 | 1.1e-10 | 32071273 | Bacterial control measured at 37ºC |
Retrieved 1 of 1 entries in 28.9 ms
(Link to these results)