Host taxon 10090
Protein NP_034101.1
granulocyte colony-stimulating factor precursor
Mus musculus
Gene Csf3, UniProt P09920
>NP_034101.1|Pseudomona aeruginosa PA01|granulocyte colony-stimulating factor precursor
MAQLSAQRRMKLMALQLLLWQSALWSGREAVPLVTVSALPPSLPLPRSFLLKSLEQVRKIQASGSVLLEQLCATYKLCHPEELVLLGHSLGIPKASLSGCSSQALQQTQCLSQLHSGLCLYQGLLQALSGISPALAPTLDLLQLDVANFATTIWQQMENLGVAPTVQPTQSAMPAFTSAFQRRAGGVLAISYLQGFLETARLALHHLA
Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●●●● 11.48 | 11.4839784409377 | 2.1e-82 | 32071273 | |
Retrieved 1 of 2 entries in 1.6 ms
(Link to these results)