Host taxon 10090
Protein NP_001334159.1
group IID secretory phospholipase A2 isoform 2
Mus musculus
Gene Pla2g2d, UniProt Q9WVF6
>NP_001334159.1|Pseudomona aeruginosa PA01|group IID secretory phospholipase A2 isoform 2
MVTHMTGKKAFFSYWPYGCHCGLGGKGQPKDATDWCCQKHDCCYAHLKIDGCKSLTDNYKYSISQGTIQCSDNGSWCERQLCACDKEVALCLKQNLDSYNKRLRYYWRPRCKGKTPAC
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●●●○ -3.24 | -3.24297690000552 | 0.037 | 32071273 | |
Retrieved 1 of 2 entries in 35.4 ms
(Link to these results)