Host taxon 10090
Protein NP_031862.1
growth arrest and DNA damage-inducible protein GADD45 alpha
Mus musculus
Gene Gadd45a, UniProt P48316
>NP_031862.1|Pseudomona aeruginosa PA01|growth arrest and DNA damage-inducible protein GADD45 alpha
MTLEEFSAAEQKTERMDTVGDALEEVLSKARSQRTITVGVYEAAKLLNVDPDNVVLCLLAADEDDDRDVALQIHFTLIRAFCCENDINILRVSNPGRLAELLLLENDAGPAESGGAAQTPDLHCVLVTNPHSSQWKDPALSQLICFCRESRYMDQWVPVINLPER
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●●○○ 2.91 | 2.90505465844983 | 6.1e-57 | 32071273 | |
Retrieved 1 of 2 entries in 59.7 ms
(Link to these results)