Host taxon 10090
Protein NP_032681.1
growth arrest and DNA damage-inducible protein GADD45 beta
Mus musculus
Gene Gadd45b, UniProt P22339
>NP_032681.1|Pseudomona aeruginosa PA01|growth arrest and DNA damage-inducible protein GADD45 beta
MTLEELVASDNAVQKMQAVTAAVEQLLVAAQRQDRLTVGVYEAAKLMNVDPDSVVLCLLAIDEEEEDDIALQIHFTLIQSFCCDNDIDIVRVSGMQRLAQLLGEPAETLGTTEARDLHCLLVTNCHTDSWKSQGLVEVASYCEESRGNNQWVPYISLEER
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●●●○ 3.21 | 3.21488628375917 | 2.4e-273 | 32071273 | |
Retrieved 1 of 1 entries in 32.1 ms
(Link to these results)