Host taxon 10090
Protein NP_035947.2
growth arrest and DNA damage-inducible protein GADD45 gamma
Mus musculus
Gene Gadd45g, UniProt Q9R0S0
>NP_035947.2|Pseudomona aeruginosa PA01|growth arrest and DNA damage-inducible protein GADD45 gamma
MTLEEVRGQDTVPESTARMQGAGKALHELLLSAQRQGCLTAGVYESAKVLNVDPDNVTFCVLAADEEDEGDIALQIHFTLIQAFCCENDIDIVRVGDVQRLAAIVGADEEGGAPGDLHCILISNPNEDTWKDPALEKLSLFCEESRSFNDWVPSITLPE
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●●●○ 3.19 | 3.18820393732443 | 1.5e-82 | 32071273 | |
Retrieved 1 of 1 entries in 41.2 ms
(Link to these results)