Host taxon 10090
Protein NP_032216.1
guanylin precursor
Mus musculus
Gene Guca2a, UniProt P33680
>NP_032216.1|Pseudomona aeruginosa PA01|guanylin precursor
MNACVLSVLCLLGALAVLVEGVTVQDGDLSFPLESVKKLKGLREVQEPRLVSHKKFAPRLLQPVAPQLCSSHSALPEALRPVCEKPNAEEILQRLEAIAQDPNTCEICAYAACTGC
Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●●●● 4.82 | 4.82001724206604 | 0.036 | 32071273 | |
Retrieved 1 of 1 entries in 1 ms
(Link to these results)