Host taxon 10090
Protein NP_115930.1
hepcidin preproprotein
Mus musculus
Gene Hamp, UniProt Q9EQ21
>NP_115930.1|Pseudomona aeruginosa PA01|hepcidin preproprotein
MALSTRTQAACLLLLLLASLSSTTYLHQQMRQTTELQPLHGEESRADIAIPMQKRRKRDTNFPICIFCCKCCNNSQCGICCKT
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●●●○ 3.22 | 3.2219790502459 | 1.4e-5 | 32071273 | |
Retrieved 1 of 1 entries in 26.9 ms
(Link to these results)