Host taxon 10090
Protein NP_001157546.1
homeobox protein TGIF1 isoform c
Mus musculus
Gene Tgif1, UniProt P70284
>NP_001157546.1|Pseudomona aeruginosa PA01|homeobox protein TGIF1 isoform c
MDSPLDLSSSAASGKRRRRGNLPKESVQILRDWLYEHRYNAYPSEQEKALLSQQTHLSTLQVCNWFINARRRLLPDMLRKDGKDPNQFTISRRGAKISEASSIEAAMGIKNFMPTLEESPFHSCVVGPNPTLGRPVSPKPPSPGSILARPSVICHTTVTALKDGPFSLCQPIGVGQSTDVPQIAPSNFTDTSLVYPEDTCKSGPSPNPQSGLFNTPPPTPPDLNQDFSGFQLLVDVALKRAAEMELQAKLTA
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●●○○ 2.87 | 2.86708447693862 | 1.4e-95 | 32071273 | |
Retrieved 1 of 3 entries in 10.1 ms
(Link to these results)