Host taxon 10090
Protein NP_780729.3
hydroxycarboxylic acid receptor 1
Mus musculus
Gene Hcar1, UniProt E9PZR8
>NP_780729.3|Pseudomona aeruginosa PA01|hydroxycarboxylic acid receptor 1
MDNGSCCLIEGEPISQVMPPLLILVFVLGALGNGIALCGFCFHMKTWKSSTIYLFNLAVADFLLMICLPLRTDYYLRRRHWIFGDIACRLVLFKLAMNRAGSIVFLTVVAVDRYFKVVHPHHMVNAISNRTAAATACVLWTLVILGTVYLLMESHLCVQGTLSSCESFIMESANGWHDVMFQLEFFLPLTIILFCSVNVVWSLRRRQQLTRQARMRRATRFIMVVASVFITCYLPSVLARLYFLWTVPTSACDPSVHTALHVTLSFTYLNSMLDPLVYYFSSPSLPKFYTKLTICSLKPKRPGRTKTRRSEEMPISNLCSKSSIDGANRSQRPSDGQWDLQVC
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●●●● -5.25 | -5.25347177172777 | 0.0013 | 32071273 | |
Retrieved 1 of 1 entries in 24.3 ms
(Link to these results)