Bacterial taxon 208964
Protein WP_003114329.1
hypothetical protein
Pseudomona aeruginosa PA01
Gene n/a, UniProt Q9HX34
>WP_003114329.1|Pseudomona aeruginosa PA01|hypothetical protein
MAELQRASVTGGGLYERLLQRLALALDEADTAERLRDEHPTELELRGLSEAEMGLIRAYLDQDLHWLRGWHAAAEELALLERQPGRTPRPPRPQPPAPRRHVSLKQRQLLCALCGAPVQWSKGHGVLPCGHCGSQLFRSGNGR
Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | pathogen | Lung tissue | 16 h | ●●●●● -4.98 | -4.98114450872376 | 7.3e-77 | 32071273 | Bacterial control measured at 37ºC |
Retrieved 1 of 1 entries in 25.4 ms
(Link to these results)