Bacterial taxon 208964
Protein WP_003092971.1
hypothetical protein
Pseudomona aeruginosa PA01
Gene anvM, UniProt Q9HXD2
>WP_003092971.1|Pseudomona aeruginosa PA01|hypothetical protein
MMFERSPDDPLPLVYACSGCSNVAQLANDLALRLDRARLAEMSCIAGVGGDVPLLVRRARSGRPILALDGCPLHCVKGCLARHEVVPTLHLTLSEHGLKKRYGEDCEAQDAERLFVELERLLTPGGKRRCE
Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | pathogen | Lung tissue | 16 h | ●●●●○ 3.47 | 3.46504072622026 | 1.7e-46 | 32071273 | Bacterial control measured at 37ºC |
Retrieved 1 of 1 entries in 29.6 ms
(Link to these results)