Bacterial taxon 208964
Protein WP_010895681.1
hypothetical protein
Pseudomona aeruginosa PA01
Gene n/a, UniProt Q9HVF3
>WP_010895681.1|Pseudomona aeruginosa PA01|hypothetical protein
MPGFFMRSGNSGGLVERVRLADADAFVGLRQVEVFMAAGGAVHQPAVVLDIEGKIDDHGLDLVQVVDQIVMFVGCGFQHDDSPVLSFAWVGFCDR
Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | pathogen | Lung tissue | 16 h | ●●●●● -8.59 | -8.5880916125246 | 2.7e-139 | 32071273 | Bacterial control measured at 37ºC |
Retrieved 1 of 1 entries in 27.5 ms
(Link to these results)