Host taxon 10090
Protein NP_038782.1
insulin-like peptide INSL6 precursor
Mus musculus
Gene Insl6, UniProt Q9QY05
>NP_038782.1|Pseudomona aeruginosa PA01|insulin-like peptide INSL6 precursor
MKQLCCSCLLWLGLLLTPFSREEEEESRPRKLCGRHLLIEVIKLCGQSDWSRFEMEEQSPMTQFFPHYSRKGKAFNPHPSSSAWRRFTNPVPAGVSQKKGTHTWEPQSLPDYQFEKTELLPKARVFSYHSGKPYVKSVQLQKKSTNKMNTFRSLFWGNHSQRKRRGFADKCCVIGCTKEEMAVACLPFVDF
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●●●● 5.21 | 5.21406277423848 | 0.02 | 32071273 | |
Retrieved 1 of 2 entries in 1 ms
(Link to these results)