Host taxon 10090
Protein NP_444318.1
interferon-induced transmembrane protein 5
Mus musculus
Gene Ifitm5, UniProt O88728
>NP_444318.1|Pseudomona aeruginosa PA01|interferon-induced transmembrane protein 5
MDTSYPREDPRAPSSRKADAAAHTALSMGTPGPTPRDHMLWSVFSTMYLNLCCLGFLALVHSVKARDQKMAGNLEAARQYGSKAKCYNILAAMWTLVPPLLLLGLVVTGALHLSKLAKDSAAFFSTKFDEEDYN
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●●●○ 3.89 | 3.8934677247391 | 3.9e-18 | 32071273 | |
Retrieved 1 of 1 entries in 41.2 ms
(Link to these results)