Host taxon 10090
Protein NP_058667.1
interleukin-22 precursor
Mus musculus
Gene Il22, UniProt Q9JJY9
>NP_058667.1|Pseudomona aeruginosa PA01|interleukin-22 precursor
MAVLQKSMSFSLMGTLAASCLLLIALWAQEANALPVNTRCKLEVSNFQQPYIVNRTFMLAKEASLADNNTDVRLIGEKLFRGVSAKDQCYLMKQVLNFTLEDVLLPQSDRFQPYMQEVVPFLTKLSNQLSSCHISGDDQNIQKNVRRLKETVKKLGESGEIKAIGELDLLFMSLRNACV
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●●●● 7.12 | 7.11818147264869 | 7.5e-10 | 32071273 | |
Retrieved 1 of 1 entries in 56.8 ms
(Link to these results)