Host taxon 10090
Protein NP_080434.1
isochorismatase domain-containing protein 2B
Mus musculus
Gene Isoc2b, UniProt Q9DCC7
>NP_080434.1|Pseudomona aeruginosa PA01|isochorismatase domain-containing protein 2B
MGAAKASLGRIFPESSILFLCDMQEKLRDRILYFPQIVSKAARMLKVAQMLEIPVLLTEHYPQGLGPTVPELGAQGLRTMSKTSFSMVPPLQQELDKLPQLQSVLLCGIETQGCILHTALDLLDRGLQVHVAVDACSSQSEMNRLVALARMQQSGVFLSTSEVLILQLVKDAAHPQFKEIQKILKEPVTDIGLLGFFQGKKNSLLPNSRT
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●●●● -5.01 | -5.00603273441119 | 0.003 | 32071273 | |
Retrieved 1 of 1 entries in 11.5 ms
(Link to these results)