Bacterial taxon 208964
Protein WP_003093625.1
isochorismatase family protein
Pseudomona aeruginosa PA01
Gene phzD1, UniProt P0DPB9
>WP_003093625.1|Pseudomona aeruginosa PA01|isochorismatase family protein
MSGIPEITAYPLPTAQQLPANLARWSLEPRRAVLLVHDMQRYFLRPLPESLRAGLVANAARLRRWCVEQGVQIAYTAQPGSMTEEQRGLLKDFWGPGMRASPADREVVEELAPGPDDWLLTKWRYSAFFHSDLLQRMRAAGRDQLVLCGVYAHVGVLISTVDAYSNDIQPFLVADAIADFSEAHHRMALEYAASRCAMVVTTDEVLE
Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | pathogen | Lung tissue | 16 h | ●●●●● -4.95 | -4.9542954794345 | 9.0e-23 | 32071273 | Bacterial control measured at 37ºC |
Retrieved 1 of 2 entries in 41.1 ms
(Link to these results)