Bacterial taxon 208964
Protein WP_003100791.1
LcrR family type III secretion system chaperone PcrR
Pseudomona aeruginosa PA01
Gene pcrR, UniProt G3XCW4
>WP_003100791.1|Pseudomona aeruginosa PA01|LcrR family type III secretion system chaperone PcrR
MSADPLIPWFLARGLAVRPHCLRDTSIALGWQVLAHGCELAWRCDGERVWIVMLRRRQARSGLANPFAALYLLAEATLDTLGPRQRLYGKVLALAGSPLPGERMARFYRRWTGAAEPADGWFELEAGRVVTQRSLRKRQKPDRA
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | pathogen | Lung tissue | 16 h | ●●●●● 4.03 | 4.02924240249974 | 1.2e-56 | 32071273 | Bacterial control measured at 37ºC |
Retrieved 1 of 1 entries in 35.4 ms
(Link to these results)