Host taxon 10090
Protein NP_666354.1
leucine-rich repeat-containing protein 10
Mus musculus
Gene Lrrc10, UniProt Q8K3W2
>NP_666354.1|Pseudomona aeruginosa PA01|leucine-rich repeat-containing protein 10
MGNTIRAFVAFIPTDRCQSYVVGDLREMPLDRMVDLSGSQLRRFPLHVCSFTELVKLYLSDNHLHSLPPDLAQLQNLQILALDFNNFKALPRVVCTLKQLCILYLGNNKLCDLPDELSLLQNLRTLWLESNCLTRLPDVVCELSLLKTLHAGSNALRLLPGQLRRLRELRTIWLSGNQLADFPSVLLRMPFLEVIDVDRNSIRYFPSLAHLTNLKLVIYDHNPCRNAPKVGKGVRRVGRWAEETPEPDPRKARRYALAKEENQEPPPPLLPSSS
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●●●○ 3.62 | 3.62338377551069 | 0.0013 | 32071273 | |
Retrieved 1 of 2 entries in 13.8 ms
(Link to these results)