Host taxon 10090
Protein NP_001028609.1
leucine-rich single-pass membrane protein 1
Mus musculus
Gene Lsmem1, UniProt Q3UQS2
>NP_001028609.1|Pseudomona aeruginosa PA01|leucine-rich single-pass membrane protein 1
MTHSSQDAGSHGIQEEGRLYVVDSINDLNKLSLCPMESQHLFSLEDKIPNAGTAPGNGRRGLFFVGLLLVLTVSLALVFFAIFLIIQTGNQMEDVSRRLTAEGKDIDDLKKINNMIVKRLNQLDSEQN
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●●●● 5.52 | 5.51576762590393 | 2.1e-7 | 32071273 | |
Retrieved 1 of 2 entries in 0.6 ms
(Link to these results)