Host taxon 10090
Protein NP_001034626.1
leukemia inhibitory factor isoform b
Mus musculus
Gene Lif, UniProt P09056
>NP_001034626.1|Pseudomona aeruginosa PA01|leukemia inhibitory factor isoform b
MNQIKNQLAQLNGSANALFISYYTAQGEPFPNNVEKLCAPNMTDFPSFHGNGTEKTKLVELYRMVAYLSASLTNITRDQKVLNPTAVSLQVKLNATIDVMRGLLSNVLCRLCNKYRVGHVDVPPVPDHSDKEAFQRKKLGCQLLGTYKQVISVVVQAF
Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●●●● 5.28 | 5.28342029482295 | 7.8e-273 | 32071273 | |
Retrieved 1 of 2 entries in 0.4 ms
(Link to these results)