Host taxon 10090
Protein NP_065244.2
lymphocyte antigen 6I precursor
Mus musculus
Gene Ly6i, UniProt Q9WU67
>NP_065244.2|Pseudomona aeruginosa PA01|lymphocyte antigen 6I precursor
MDTSHAIKSCVLILLVTLLCAERAQGLECYQCYGVPFETSCPSFTCPYPDGFCVAQEEEFIANSQRKKVKSRSCHPFCPDEIEKKFILDPNTKMNISCCQEDLCNAAVPTGGSSWTTAGVLLFSLGSVLLQTLM
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●●●○ 3.01 | 3.01102823829968 | 4.8e-11 | 32071273 | |
Retrieved 1 of 1 entries in 3 ms
(Link to these results)