Bacterial taxon 208964
Protein WP_003084001.1
malonate decarboxylase subunit delta
Pseudomona aeruginosa PA01
Gene mdcC, UniProt Q9I6S8
>WP_003084001.1|Pseudomona aeruginosa PA01|malonate decarboxylase subunit delta
METLTFEFPAGAPARGRALAGCVGSGDLEVLLEPAAGGALSIQVVTSVNGSGPRWQQLFARVFAASTAPAASIRIHDFGATPGVVRLRLEQALEEAGHD
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | pathogen | Lung tissue | 16 h | ●●●●● -5.05 | -5.05114626403902 | 1.1e-8 | 32071273 | Bacterial control measured at 37ºC |
Retrieved 1 of 1 entries in 28.4 ms
(Link to these results)