Bacterial taxon 208964
Protein WP_010895554.1
MoaD/ThiS family protein
Pseudomona aeruginosa PA01
Gene n/a, UniProt Q9I3Y9
>WP_010895554.1|Pseudomona aeruginosa PA01|MoaD/ThiS family protein
MADERRCGVCRPLGGPRQPWPAGLLHCSSRAIFASLCMPRIVFAPAIQRHVAMPALDVGAATVAAALQAAFAREPRLRGYLLDDQGSLRRHVALFVDGVQVRDRRGLGDPLQDDSEIYVVQALSGG
Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | pathogen | Lung tissue | 16 h | ●●●●● -6.78 | -6.77682016141173 | 5.8e-8 | 32071273 | Bacterial control measured at 37ºC |
Retrieved 1 of 1 entries in 1 ms
(Link to these results)