Host taxon 10090
Protein NP_001136264.1
modulator of macroautophagy TMEM150B isoform 1
Mus musculus
Gene Tmem150b, UniProt Q8R218
>NP_001136264.1|Pseudomona aeruginosa PA01|modulator of macroautophagy TMEM150B isoform 1
MWNYLSLLPVILFLWAIAGIWIVFAIAVVNGSVDLNEGFPFISICGSYAPQSCIFGQVLNIGAALTVWICIVRHHQLRDWGVKTWQNQLILWSGILCALGTSIVGNFQDKNQKPTHLAGAFLAFILGNLYFWLQFFLSWWVKGLPQPGPHWIKSLRLSLCSLSTILIVAMIVLHALHMRSASAICEWVVAMLLFMLFGFFAVDFSILRGCTLHLHPRLDSSLPQAPSGSPNIQMAQVL
Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●●●○ -3.26 | -3.25585548366002 | 0.0099 | 32071273 | |
Retrieved 1 of 1 entries in 24.3 ms
(Link to these results)