Host taxon 10090
Protein NP_919245.1
MORN repeat-containing protein 2
Mus musculus
Gene Morn2, UniProt Q6UL01
>NP_919245.1|Pseudomona aeruginosa PA01|MORN repeat-containing protein 2
MNGFGRLEHFSGAVYEGQFKDNMFHGLGTYTFPTGAKYTGNFNENRVEGEGEYTDTQGLQWCGNFHFTAAPGLKLKLYM
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●●●○ -3.92 | -3.91743281538919 | 0.0042 | 32071273 | |
Retrieved 1 of 1 entries in 74.6 ms
(Link to these results)