Host taxon 10090
Protein NP_081069.1
myc target protein 1
Mus musculus
Gene Myct1, UniProt Q8R411
>NP_081069.1|Pseudomona aeruginosa PA01|myc target protein 1
MANNTTSLGSPWPENFWEDLIMSFTVSVAIGLAIGGFLWALFVFLSRRRRASAPISQWSPTRRPRSSYNHGLNRTGFYRHSGYERRSNLSLASLTFQRQASMELVNSFPRKSSFRASTFHPFLQCPPLPVETESQLMTLSASTTPSTLSTAHSPSRPDFRWSSNSLRMGLSTPPPPAYESIIKAFPDS
Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●●●○ -3.44 | -3.43569894474209 | 9.8e-44 | 32071273 | |
Retrieved 1 of 1 entries in 22.2 ms
(Link to these results)