Host taxon 10090
Protein NP_001104528.1
myeloid cell surface antigen CD33 isoform 1 precursor
Mus musculus
Gene Cd33, UniProt Q63994
>NP_001104528.1|Pseudomona aeruginosa PA01|myeloid cell surface antigen CD33 isoform 1 precursor
MLWPLPLFLLCAGSLAQDLEFQLVAPESVTVEEGLCVHVPCSVFYPSIKLTLGPVTGSWLRKGVSLHEDSPVATSDPRQLVQKATQGRFQLLGDPQKHDCSLFIRDAQKNDTGMYFFRVVREPFVRYSYKKSQLSLHVTSLSRTPDIIIPGTLEAGYPSNLTCSVPWACEQGTPPTFSWMSTALTSLSSRTTDSSVLTFTPQPQDHGTKLTCLVTFSGAGVTVERTIQLNVTRKSGQMRELVLVAVGEATVKLLILGLCLVFLIVMFCRRKTTKLSVHMGCENPIKRQEAITSYNHCLSPTASDAVTPGCSIHRLISRTPRCTAILRIQDPYRRTHLRNRAVSTLRFPWISWEGSLRSTQRSKCTKLCSPVKNLCPLWLPVDNSCIPLIPEWVMLLCVSLTLS
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●●●● 4.52 | 4.52093258957137 | 1.5e-268 | 32071273 | |
Retrieved 1 of 1 entries in 5.7 ms
(Link to these results)