Host taxon 10090
Protein NP_034991.3
myosin regulatory light chain 2, ventricular/cardiac muscle isoform
Mus musculus
Gene Myl2, UniProt P51667
>NP_034991.3|Pseudomona aeruginosa PA01|myosin regulatory light chain 2, ventricular/cardiac muscle isoform
MAPKKAKKRIEGGSSNVFSMFEQTQIQEFKEAFTIMDQNRDGFIDKNDLRDTFAALGRVNVKNEEIDEMIKEAPGPINFTVFLTMFGEKLKGADPEETILNAFKVFDPEGKGSLKADYVREMLTTQAERFSKEEIDQMFAAFPPDVTGNLDYKNLVHIITHGEEKD
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●●●● 5.46 | 5.46048326224365 | 0.0046 | 32071273 | |
Retrieved 1 of 1 entries in 0.5 ms
(Link to these results)