Host taxon 10090
Protein NP_918953.2
nanos homolog 2
Mus musculus
Gene Nanos2, UniProt P60322
>NP_918953.2|Pseudomona aeruginosa PA01|nanos homolog 2
MDLPPFDMWRDYFNLSQVVMDIIQSRKQRQEGEVAEEPNSRPQEKSEQDLEGYPGCLPTICNFCKHNGESRHVYTSHQLKTPEGVVVCPILRHYVCPLCGATGDQAHTLKYCPLNSSQQSLYRRSGRNSAGRRVKR
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●●●○ 3.62 | 3.61955406651023 | 0.041 | 32071273 | |
Retrieved 1 of 2 entries in 31.1 ms
(Link to these results)