Host taxon 10090
Protein NP_001157083.1
neuropeptide S precursor
Mus musculus
Gene Nps, UniProt P0C0P8
>NP_001157083.1|Pseudomona aeruginosa PA01|neuropeptide S precursor
MIGSLKLSFVLALSLSVMHVLWCYPVLSSKVPGKPDYFLILLSSCPARLEGSDRLAFLKPILEKTSMKRSFRNGVGSGAKKTSFRRAKQ
Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●●●● 5.1 | 5.09739312737034 | 0.017 | 32071273 | |
Retrieved 1 of 1 entries in 0.9 ms
(Link to these results)