Host taxon 10090
Protein NP_079725.1
nicolin-1 isoform 1
Mus musculus
Gene Nicn1, UniProt Q9CQM0
>NP_079725.1|Pseudomona aeruginosa PA01|nicolin-1 isoform 1
MSRVLVPCHVKSTVALQVGDMRTSQGRPGVLVVDVTFPNIAPFELQEIMFKNYYTAFLSIRVRQQSSMHTAAKWVTCLRDYCLMPDPHSEEGAQDYVSLFKHQMLCDMNRVLELRLILRQPSPLWLSFTVEELQIYQQGPKSPSLAFPKWLSHPVSNEQPAPRLEGLPDPSRVSSEVQQMWALTEMIRASHTSTRIGRFDVDGCYDLNLLSYT
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●●●○ -3.43 | -3.42725122617031 | 1.5e-11 | 32071273 | |
Retrieved 1 of 1 entries in 12.1 ms
(Link to these results)