Bacterial taxon 208964
Protein WP_003087853.1
nitrite reductase small subunit NirD
Pseudomona aeruginosa PA01
Gene nirD, UniProt Q9I2W2
>WP_003087853.1|Pseudomona aeruginosa PA01|nitrite reductase small subunit NirD
MNWLDICSLDEINPLGSRVVAGPKGDIAIFRAADDQVFALDDRCPHKGGPLSQGLIYGKRVACPLHNWQIELESGEAVAPDQGCAHRHPVRVENGRVLLGLDSVALCA
Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | pathogen | Lung tissue | 16 h | ●●●●○ -3.2 | -3.20193364934724 | 0.023 | 32071273 | Bacterial control measured at 37ºC |
Retrieved 1 of 1 entries in 22.3 ms
(Link to these results)