Host taxon 10090
Protein NP_001004174.1
normal mucosa of esophagus-specific gene 1 protein
Mus musculus
Gene AA467197, UniProt Q3UCF3
>NP_001004174.1|Pseudomona aeruginosa PA01|normal mucosa of esophagus-specific gene 1 protein
MGVFQILMKNKELIPLAFFISVAATGATSFALYALKKTDVVIDRKRNPEPWEMVDPTQPQKLITINQQWKPVEELQKVRRATR
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●●●● 5.3 | 5.30194910257071 | 0.011 | 32071273 | |
Retrieved 1 of 1 entries in 0.6 ms
(Link to these results)