Bacterial taxon 208964
Protein WP_003095213.1
nucleotide exchange factor GrpE
Pseudomona aeruginosa PA01
Gene grpE, UniProt Q9HV42
>WP_003095213.1|Pseudomona aeruginosa PA01|nucleotide exchange factor GrpE
MADEQQTLDQQTPEQPTGAAEDLTARVQELEEQLAAAQDQALRMVADLQNVRRRAEQDVEKAHKFALEKFAGDLLAVVDTLERGLEMSDPNDEAIKPMREGMELTLKMFDDTLRRYQVEALNPEGEPFNPEQHQAMAMQESASAEPGSVLKVFQKGYLLNGRLLRPAMVVVSKAPAETPPSIDEQA
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | pathogen | Lung tissue | 16 h | ●●●●○ 3.16 | 3.16309598974885 | 7.9e-222 | 32071273 | Bacterial control measured at 37ºC |
Retrieved 1 of 1 entries in 27.6 ms
(Link to these results)