Bacterial taxon 208964
Protein WP_003102492.1
PA-I galactophilic lectin
Pseudomona aeruginosa PA01
Gene lecA, UniProt Q05097
>WP_003102492.1|Pseudomona aeruginosa PA01|PA-I galactophilic lectin
MAWKGEVLANNEAGQVTSIIYNPGDVITIVAAGWASYGPTQKWGPQGDREHPDQGLICHDAFCGALVMKIGNSGTIPVNTGLFRWVAPNNVQGAITLIYNDVPGTYGNNSGSFSVNIGKDQS
Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | pathogen | Lung tissue | 16 h | ●●●●● -9.27 | -9.26854287298054 | 2.4e-54 | 32071273 | Bacterial control measured at 37ºC |
Retrieved 1 of 1 entries in 13.5 ms
(Link to these results)